Pseudocercospora fijiensis: MYCFIDRAFT_123664 Help Entry MYCFIDRAFT_123664 CDS       T03109                                  Name (RefSeq) hypothetical protein   KO K01724   4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96] Organism pfj  Pseudocercospora fijiensis Pathway pfj00790   Folate biosynthesis pfj01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:pfj00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MYCFIDRAFT_123664  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfj04147]     MYCFIDRAFT_123664 Enzymes [BR:pfj01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.1  Hydro-lyases     4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase      MYCFIDRAFT_123664 Exosome [BR:pfj04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    MYCFIDRAFT_123664 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pterin_4a Motif Other DBs NCBI-GeneID:  19330507 NCBI-ProteinID:  XP_007921563 JGI:  123664 UniProt:  N1QBK8 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search WKLCNDGKGLERGFKFKTFKTTWEFMNDVAAECKKVKHHPEWSNVYNKAHIRWTTHDPEG LSSKDTSMAKFCDDAAKRL NT seq 237 nt NT seq  +upstreamnt  +downstreamnt tggaagctctgtaacgatggaaaagggctggagagagggttcaaattcaagaccttcaag acgacatgggagttcatgaacgacgtggcggccgaatgcaagaaggtgaagcaccaccct gaatggagcaatgtatacaacaaggcccatatacgatggacgacccacgatccagaggga ctttcgagcaaagatactagcatggccaagttctgcgatgacgcggcgaaaagactt

DBGET integrated database retrieval system