Pseudomonas protegens Pf-5: PFL_5658 Help Entry PFL_5658          CDS       T00249                                  Symbol folB_2 Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pfl  Pseudomonas protegens Pf-5 Pathway pfl00790   Folate biosynthesis pfl01100   Metabolic pathways pfl01240   Biosynthesis of cofactors Module pfl_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pfl00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PFL_5658 (folB_2) Enzymes [BR:pfl01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PFL_5658 (folB_2)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PFL_5658 (folB_2)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PFL_5658 (folB_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AAY94851 UniProt:  Q4K4W6 LinkDB All DBs Position complement(6444982..6445335) Genome browser AA seq 117 aa AA seqDB search MDRVFIEGLEVDTVIGAYDWERGIRQCLRLDLSFAWDNRPAAAGDDLTLALDYASVSTRI QAFAEHAQYQLVETFAERLAEVLMNEFHIPWLRLKLTKPGAVPAASGVGVEIERGCR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt ttggacagagtgtttatcgaagggctggaagtggacaccgtgattggtgcctacgactgg gagcgcggcatccgacagtgcctgcgtcttgatctgagctttgcctgggacaatcgcccg gcagctgctggagatgatctgacgctggcattggactatgccagtgtctccacccggatc caggcgtttgccgagcatgcccagtaccagttggtggaaacctttgccgagcgccttgcc gaggttctgatgaatgaatttcacatcccttggttgcgcttgaaactgaccaagcctggc gccgtcccggctgcctcgggtgtgggtgtggagatcgagcgcggatgtcgctga

DBGET integrated database retrieval system