Phytohabitans flavus: Pflav_015400 Help Entry Pflav_015400      CDS       T06516                                  Symbol mbtH_1 Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism pfla  Phytohabitans flavus Pathway pfla00261   Monobactam biosynthesis pfla01100   Metabolic pathways pfla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfla00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pflav_015400 (mbtH_1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfla01008]     Pflav_015400 (mbtH_1) Polyketide biosynthesis proteins [BR:pfla01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pflav_015400 (mbtH_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCB75130 UniProt:  A0A6F8XMT9 LinkDB All DBs Position complement(1735099..1735293) Genome browser AA seq 64 aa AA seqDB search MAEQEYLVVRNDEEQFSIWAQDAPVPAGWQATGFAGSRDRCLAHIDEVWTDMRPRSLRVA MGEA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggctgagcaggagtacctcgtggtccgcaacgacgaggagcagttctcgatctgggcg caggacgcgccggtaccggccggctggcaggccaccggcttcgccggcagccgcgaccgg tgcctggcacacatcgacgaggtctggaccgacatgcgcccgcgcagcctgcgagtcgcg atgggtgaggcctga

DBGET integrated database retrieval system