Phytohabitans flavus: Pflav_032780 Help Entry Pflav_032780      CDS       T06516                                  Symbol mbtH_2 Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism pfla  Phytohabitans flavus Pathway pfla00261   Monobactam biosynthesis pfla01100   Metabolic pathways pfla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfla00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pflav_032780 (mbtH_2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfla01008]     Pflav_032780 (mbtH_2) Polyketide biosynthesis proteins [BR:pfla01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pflav_032780 (mbtH_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCB76868 UniProt:  A0A6F8XSZ9 LinkDB All DBs Position complement(3571451..3571651) Genome browser AA seq 66 aa AA seqDB search MTDELTYRVVVNDEEQYSIWAADRELPAGWHAEGTEGTKQECLARIAEVWTDMRPLSLRR RMEQAA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgactgatgagctgacctaccgcgtcgtcgtcaacgacgaggagcagtactcgatctgg gccgccgaccgcgagcttcccgccggctggcacgccgagggcaccgaggggaccaagcag gagtgcctcgcgcggatcgccgaggtgtggaccgacatgcgcccgctgagcctgcgccgc cgcatggagcaggcggcctag

DBGET integrated database retrieval system