Phytohabitans flavus: Pflav_036440 Help Entry Pflav_036440      CDS       T06516                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism pfla  Phytohabitans flavus Pathway pfla00261   Monobactam biosynthesis pfla01100   Metabolic pathways pfla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfla00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pflav_036440  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfla01008]     Pflav_036440 Polyketide biosynthesis proteins [BR:pfla01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pflav_036440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCB77234 UniProt:  A0A6F8XTS2 LinkDB All DBs Position complement(3960688..3960897) Genome browser AA seq 69 aa AA seqDB search MTNPFEDPEGRYYVLVNEEDQHSLWPSFVDVPEGWTAVFGEDSRDACLAYVEAHWTDLRP RSLREAMAD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgaccaacccgttcgaggaccccgagggtcgctactacgtgctcgtcaacgaggaggac cagcactcgctctggccgtccttcgtggacgtacccgagggctggacggccgttttcggc gaggattcgcgggacgcctgcctcgcgtacgtcgaggcacactggaccgacctgcgcccg cgcagcctccgcgaggcgatggccgactga

DBGET integrated database retrieval system