Pseudomonas fluorescens Pf0-1: Pfl01_2269 Help Entry Pfl01_2269        CDS       T00283                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism pfo  Pseudomonas fluorescens Pf0-1 Pathway pfo00261   Monobactam biosynthesis pfo01100   Metabolic pathways pfo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pfl01_2269  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfo01008]     Pfl01_2269 Polyketide biosynthesis proteins [BR:pfo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pfl01_2269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABA74012 UniProt:  Q3KDZ4 LinkDB All DBs Position 2621715..2621921 Genome browser AA seq 68 aa AA seqDB search MNDAQLQFDVVINAQGQYSLWPAGKPMASGWSEAGMRGERQVCLDYINEHWIDMRPRSLR EQSSVSFQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaatgacgcacaactgcaattcgatgtggtgatcaacgctcagggtcagtattccctg tggccggcgggcaagccgatggccagcggttggagcgaggcggggatgcgcggtgagcgc caggtctgcctggattacatcaacgagcactggatcgacatgcgcccgcgctcgctgcgt gagcagtcatcggtgtcgttccaataa

DBGET integrated database retrieval system