Pseudomonas fluorescens Pf0-1: Pfl01_3931 Help Entry Pfl01_3931        CDS       T00283                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism pfo  Pseudomonas fluorescens Pf0-1 Pathway pfo00261   Monobactam biosynthesis pfo01100   Metabolic pathways pfo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pfl01_3931  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfo01008]     Pfl01_3931 Polyketide biosynthesis proteins [BR:pfo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pfl01_3931 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABA75668 UniProt:  Q3K986 LinkDB All DBs Position complement(4445418..4445642) Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAIPEGWRTVGKSGLKKECLAYIEEVWTDMRP LSLRQKMEAQAAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaagtcgtggtcaaccacgaagag cagtactcgatctggccggactacaaggctatcccggaaggctggcgcaccgtgggcaag agcggcctgaagaaggaatgcctggcctacatcgaagaggtctggaccgacatgcgcccg ctgagcctgcgccagaagatggaagcgcaagcggctgcccagtaa

DBGET integrated database retrieval system