Poecilia formosa (Amazon molly): 103132983 Help Entry 103132983         CDS       T07984                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor00860   Porphyrin metabolism pfor04216   Ferroptosis pfor04217   Necroptosis Brite KEGG Orthology (KO) [BR:pfor00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     103132983  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     103132983    04217 Necroptosis     103132983  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfor04147]     103132983 Enzymes [BR:pfor01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      103132983 Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103132983   Exosomal proteins of bladder cancer cells    103132983 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Rubrerythrin FCH Motif Other DBs NCBI-GeneID:  103132983 NCBI-ProteinID:  XP_007544794 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MESQVRQNYHRDCEAAINRMVNMEMFASYTYTSMAHYFCRDDVALPGFSHFFKENSEEER EHADKLLSFQNKRGGRIFLQDIKASAVNAYTVHEVDFDI NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggaatcccaggtgcgtcagaactaccaccgcgactgcgaggccgccattaacaggatg gtcaacatggagatgtttgcctcctacacctacacctctatggctcattacttctgccgc gacgacgtggccctgccgggcttctcccatttcttcaaggagaacagtgaggaggagagg gagcatgccgacaagctgttgtccttccagaacaaaagaggaggccgcatcttcctccag gatatcaaggcaagtgcagttaatgcatatacagtacacgaagtggactttgacatttaa

DBGET integrated database retrieval system