Pseudozyma flocculosa: PFL1_03299 Help Entry PFL1_03299        CDS       T03141                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism pfp  Pseudozyma flocculosa Pathway pfp03020   RNA polymerase pfp03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pfp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PFL1_03299   09124 Replication and repair    03420 Nucleotide excision repair     PFL1_03299  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pfp03021]     PFL1_03299    03400 DNA repair and recombination proteins [BR:pfp03400]     PFL1_03299 Transcription machinery [BR:pfp03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PFL1_03299   RNA polymerase III system    RNA polymerase III      PFL1_03299   RNA polymerase I system    RNA polymerase I      PFL1_03299 DNA repair and recombination proteins [BR:pfp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PFL1_03299 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  19317409 NCBI-ProteinID:  XP_007879007 UniProt:  A0A061H9B4 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MSDREDAGEETFYDDNDEQFDADDLADDQVDDPAADDANGIVHSSAGGDPNGAVAGQPNA ERITTPYMTKYERARILGTRALQISMNAPVLVPTEGETDPLEIAMKELAAKKIPLVVRRY LPDGTYEDWTVSELITSD NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccgagaagacgcaggcgaagagaccttctacgacgacaacgacgagcagttt gacgcggatgacttggccgacgaccaggtcgacgacccggccgccgacgacgcaaacggc atcgtccactcgagcgcaggaggtgaccccaacggcgcagtggcgggccagccaaacgcc gaacgcatcaccacgccatacatgaccaagtacgagcgtgcacgcatcctcggcacaaga gccctgcagatcagcatgaacgcgccggtgcttgtgccgacagagggcgagactgatccg ctcgagatcgccatgaaggagcttgcggcaaagaagatcccgctcgtggtccgaagatac ctgccggatggtacctacgaggactggaccgtatctgagctcatcaccagcgactaa

DBGET integrated database retrieval system