Pestalotiopsis fici: PFICI_15351 Help Entry PFICI_15351       CDS       T04924                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism pfy  Pestalotiopsis fici Pathway pfy03020   RNA polymerase pfy03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pfy00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PFICI_15351   09124 Replication and repair    03420 Nucleotide excision repair     PFICI_15351  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pfy03021]     PFICI_15351    03400 DNA repair and recombination proteins [BR:pfy03400]     PFICI_15351 Transcription machinery [BR:pfy03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PFICI_15351   RNA polymerase III system    RNA polymerase III      PFICI_15351   RNA polymerase I system    RNA polymerase I      PFICI_15351 DNA repair and recombination proteins [BR:pfy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PFICI_15351 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD HypA Motif Other DBs NCBI-GeneID:  19280364 NCBI-ProteinID:  XP_007842123 UniProt:  W3WGM8 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MSREGYQIPTGSSGAPGAGNSAVASRAIETEGLPMLYICGDCGTKFPLKRGDTIRCIECG CRVLYKERTKRMVQFEAR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctcgcgagggctaccaaattcccaccggcagctccggcgctccaggcgctggaaac tcggccgtcgccagccgtgccatcgagaccgagggtcttcccatgctctatatctgcggc gactgcggtaccaagttccctctgaagcgaggagacacgattcgttgcattgagtgcggt tgccgtgtgctctacaaggagagaaccaagagaatggttcagttcgaggcgcggtag

DBGET integrated database retrieval system