Pseudomonas germanica: J0G10_21120 Help Entry J0G10_21120       CDS       T08191                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pgf  Pseudomonas germanica Pathway pgf00261   Monobactam biosynthesis pgf01100   Metabolic pathways pgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     J0G10_21120  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pgf01008]     J0G10_21120 Polyketide biosynthesis proteins [BR:pgf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     J0G10_21120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QYY80221 LinkDB All DBs Position complement(4784929..4785153) Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGLKKECLAYIEEVWTDMRP LSLRQKMEAQAAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag caatactcgatctggccggactacaaagccgtgccgcaaggctggcgcaccgtgggcaag agcggcctgaaaaaggaatgcctggcctatatcgaagaagtctggaccgacatgcgtccg ctgagtctgcgtcagaagatggaagcccaggccgccgcgcaataa

DBGET integrated database retrieval system