Pseudomonas graminis: FX982_03430 Help Entry FX982_03430       CDS       T06934                                  Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism pgg  Pseudomonas graminis Pathway pgg00261   Monobactam biosynthesis pgg01100   Metabolic pathways pgg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FX982_03430  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pgg01008]     FX982_03430 Polyketide biosynthesis proteins [BR:pgg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FX982_03430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Ribosomal_S22 Motif Other DBs NCBI-ProteinID:  QKF52445 UniProt:  A0A6M8MVC9 LinkDB All DBs Position 3813911..3814111 Genome browser AA seq 66 aa AA seqDB search MSFDSESTQFRVVINHEEQYSIWPDYKAIPDGWKSVGVEGDKQTCLNHIESVWTDMRPLS LRKAMA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcttcgacagcgaaagcacacagttccgggtcgtcatcaaccacgaagaacagtac tccatctggcccgactacaaagccatcccggacggctggaaaagcgtcggcgtcgaaggc gacaaacagacctgcctcaaccacatcgaaagcgtctggaccgacatgcgtcccctcagc ctgcgcaaggccatggcctga

DBGET integrated database retrieval system