Paenibacillus glucanolyticus: A3958_00945 Help Entry A3958_00945       CDS       T09937                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism pglu  Paenibacillus glucanolyticus Pathway pglu00261   Monobactam biosynthesis pglu01100   Metabolic pathways pglu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pglu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A3958_00945  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pglu01008]     A3958_00945 Polyketide biosynthesis proteins [BR:pglu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A3958_00945 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANA78648 LinkDB All DBs Position complement(202113..202340) Genome browser AA seq 75 aa AA seqDB search MTNPFEQADGKYVVLMNHEGQYSLWPAFAAIPDGWTQALGLSTREECMTYINENWVDLRP RSLYANAGSAPENRP NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccttttgaacaagccgatggcaaatatgtcgtattgatgaatcatgaggga caatattcgctttggccggctttcgcggctattccagatggctggactcaagcgctgggg cttagcacacgagaagagtgcatgacctacatcaacgaaaactgggtcgatttacggccg cggagtttatatgcgaatgccggatcggcaccggaaaacaggccatga

DBGET integrated database retrieval system