Porphyromonas gingivalis TDC60: PGTDC60_0078 Help Entry PGTDC60_0078      CDS       T01516                                  Name (GenBank) ferredoxin, 4Fe-4S   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pgt  Porphyromonas gingivalis TDC60 Pathway pgt00020   Citrate cycle (TCA cycle) pgt01100   Metabolic pathways pgt01110   Biosynthesis of secondary metabolites pgt01120   Microbial metabolism in diverse environments pgt01200   Carbon metabolism pgt01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pgt00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PGTDC60_0078 Enzymes [BR:pgt01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PGTDC60_0078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_16 Fer4_9 Fer4_15 Fer4_4 Fer4_3 Fer4_17 Fer4_22 Fer4_13 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  BAK24248 LinkDB All DBs Position 95323..95550 Genome browser AA seq 75 aa AA seqDB search MAKIRGAVVVNTQRCKGCNLCVVACPTKVLELHPNEVNDKGYHYSYMKDPESCIGCTSCA TVCPDACITVYKVKL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatcagaggagctgtggtcgttaatacccagcgttgcaaaggttgcaatcta tgtgtagtggcttgcccgacaaaagtgctggagctacacccgaatgaagtcaatgacaaa ggctatcattactcttatatgaaagatcccgaaagctgtatcggctgcaccagttgtgca acggtatgcccggacgcatgtatcacggtttacaaagtgaaattgtaa

DBGET integrated database retrieval system