Meyerozyma guilliermondii: PGUG_04989 Help Entry PGUG_04989        CDS       T01150                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism pgu  Meyerozyma guilliermondii Pathway pgu03020   RNA polymerase pgu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pgu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PGUG_04989   09124 Replication and repair    03420 Nucleotide excision repair     PGUG_04989  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pgu03021]     PGUG_04989    03400 DNA repair and recombination proteins [BR:pgu03400]     PGUG_04989 Transcription machinery [BR:pgu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PGUG_04989   RNA polymerase III system    RNA polymerase III      PGUG_04989   RNA polymerase I system    RNA polymerase I      PGUG_04989 DNA repair and recombination proteins [BR:pgu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PGUG_04989 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD HypA zinc-ribbon_6 FYDLN_acid HVO_2753_ZBP Prok-RING_1 C1_1 FYVE_2 DUF1451 YjdM_Zn_Ribbon zinc_ribbon_5 Zn-ribbon_8 Motif Other DBs NCBI-GeneID:  5124536 NCBI-ProteinID:  XP_001483034 UniProt:  A5DNY8 LinkDB All DBs AA seq 73 aa AA seqDB search MSSPQREGFTAPASISHAAHGQVTNKSLGVKYNCAQCATSFSLGKSDAIRCKECGHRVIY KSRTRRMVQFEAR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgccacaaagagagggtttcaccgcccctgcgtccatctcacacgctgcacac ggtcaggtcaccaacaagtccttgggggtcaaatacaactgtgctcaatgtgctacttcg ttttctttgggaaagagcgatgctatacggtgtaaagaatgcggtcatagggtgatatac aagtcccggacaagacgtatggtgcagtttgaggccaggtag

DBGET integrated database retrieval system