Pseudomonas glycinae: AWU82_00245 Help Entry AWU82_00245       CDS       T06994                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pgy  Pseudomonas glycinae Pathway pgy00261   Monobactam biosynthesis pgy01100   Metabolic pathways pgy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AWU82_00245  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pgy01008]     AWU82_00245 Polyketide biosynthesis proteins [BR:pgy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AWU82_00245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AMQ81768 LinkDB All DBs Position 1069206..1069430 Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAIPEGWRTVGKSGLKKECLAYIEEVWTDMRP LSLSQKMEAQAAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaagtcgtggtcaaccacgaagag cagtactcgatctggccggactacaaggctatcccggaaggctggcgcaccgtgggcaag agcggcctgaagaaggaatgcctggcctacatcgaagaagtctggaccgacatgcgcccg ctgagcctgagtcagaagatggaagcgcaagcggctgcccagtaa

DBGET integrated database retrieval system