Pseudomonas hormoni: KJF94_17530 Help Entry KJF94_17530       CDS       T09556                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism phom  Pseudomonas hormoni Pathway phom00261   Monobactam biosynthesis phom01100   Metabolic pathways phom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phom00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KJF94_17530  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:phom01008]     KJF94_17530 Polyketide biosynthesis proteins [BR:phom01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KJF94_17530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QVW21703 LinkDB All DBs Position complement(3771736..3771963) Genome browser AA seq 75 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGLKKECLAYIEETWTDMRP LSLRRKMEEQAAVAH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag cagtactcgatctggcccgactacaaagccgtgccggaaggctggcgcaccgtgggcaag agcgggctgaaaaaggaatgcctggcttacatcgaagaaacctggacggacatgcgtccg ttgagcttgcgcaggaagatggaagagcaggcggctgtggctcactaa

DBGET integrated database retrieval system