Pseudomonas hamedanensis: HU739_000015 Help Entry HU739_000015      CDS       T07661                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism phv  Pseudomonas hamedanensis Pathway phv00261   Monobactam biosynthesis phv01100   Metabolic pathways phv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU739_000015  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:phv01008]     HU739_000015 Polyketide biosynthesis proteins [BR:phv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU739_000015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI17418 UniProt:  A0A9E6P095 LinkDB All DBs Position 2242..2466 Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGLKKECLAYIEEVWTDMRP LSLRQKMEAQVAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag caatactcgatctggccggattacaaagcggtaccagagggctggcgcaccgtgggcaag agcggcctgaaaaaggaatgcctggcctacatcgaagaagtgtggaccgacatgcgcccg ctgagcctgcgtcagaagatggaagcgcaagtcgcggcacaataa

DBGET integrated database retrieval system