Pseudothermotoga hypogea: AJ81_02220 Help Entry AJ81_02220        CDS       T04277                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism phy  Pseudothermotoga hypogea Pathway phy00020   Citrate cycle (TCA cycle) phy01100   Metabolic pathways phy01110   Biosynthesis of secondary metabolites phy01120   Microbial metabolism in diverse environments phy01200   Carbon metabolism phy01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:phy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AJ81_02220 Enzymes [BR:phy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AJ81_02220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_7 Fer4_9 Fer4_4 Fer4_21 Fer4_16 Fer4_3 Fer4_13 Fer4_15 Fer4_17 Fer4_8 PknG_rubred Motif Other DBs NCBI-ProteinID:  AJC73217 UniProt:  A0A0X1KPJ4 LinkDB All DBs Position complement(416504..416731) Genome browser AA seq 75 aa AA seqDB search MKKQYDIHINYEWCKRCGICYSFCPTGALAKGELLKPIVTDRNKCIGCLMCENLCPDFAI AIKQLEVVQGSVDNA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtgaagaagcagtacgacatacacatcaactacgaatggtgtaagagatgtgggatatgt tacagtttctgtccgacgggagcgttagcgaaaggcgaattactcaaaccaattgtcacc gatcgcaacaagtgcatcggctgtttgatgtgtgagaacctctgtccagatttcgccatc gccatcaaacaactcgaagtggtccaagggagtgttgataatgcctga

DBGET integrated database retrieval system