Pseudomonas iranensis: HU724_019720 Help Entry HU724_019720      CDS       T07894                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pie  Pseudomonas iranensis Pathway pie00261   Monobactam biosynthesis pie01100   Metabolic pathways pie01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pie00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU724_019720  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pie01008]     HU724_019720 Polyketide biosynthesis proteins [BR:pie01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU724_019720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI21236 LinkDB All DBs Position complement(4391718..4391942) Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGLKKECLAYIEEVWTDMRP LSLRQKMDAQVAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag caatactcgatctggcccgattacaaagccgtgccccaaggctggcgcaccgtgggcaag agcggcctgaaaaaggaatgcctggcctatatcgaagaagtctggaccgacatgcgccca ttgagcctgcgccagaagatggatgcgcaagtcgcggcgcaataa

DBGET integrated database retrieval system