Paenibacillus sp. IHBB 10380: UB51_13745 Help Entry UB51_13745        CDS       T03836                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism pih  Paenibacillus sp. IHBB 10380 Pathway pih00261   Monobactam biosynthesis pih01100   Metabolic pathways pih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pih00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     UB51_13745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pih01008]     UB51_13745 Polyketide biosynthesis proteins [BR:pih01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     UB51_13745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJS59350 UniProt:  A0A0D3VBC4 LinkDB All DBs Position complement(3103783..3103977) Genome browser AA seq 64 aa AA seqDB search MTNPFENTDGIYVVLVNDEGQYSLWPAFAQIPAGWIVVYEQDSRQGCLDHINSQWTDMRP KSLL NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccttttgagaacaccgacggcatttacgtagtactagtgaatgacgaaggc cagtattcactgtggcctgcctttgcccagattccagctggatggatcgttgtctatgaa caagacagtcgtcaggggtgtctagaccacatcaactcgcaatggactgatatgcgacca aagagcttactatag

DBGET integrated database retrieval system