Peptoniphilus ivorii: NCTC13079_00398 Help Entry NCTC13079_00398   CDS       T06636                                  Name (GenBank) Ferredoxin II   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism piv  Peptoniphilus ivorii Pathway piv00020   Citrate cycle (TCA cycle) piv01100   Metabolic pathways piv01110   Biosynthesis of secondary metabolites piv01120   Microbial metabolism in diverse environments piv01200   Carbon metabolism piv01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:piv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     NCTC13079_00398 Enzymes [BR:piv01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      NCTC13079_00398 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_9 Fer4_10 Fer4_4 Fer4_16 Fer4_8 Fer4_15 Fer4_17 Fer4_13 Fer4_3 Fer4_22 Fer4_18 ETF_QO DUF678 Motif Other DBs NCBI-ProteinID:  VEJ34929 UniProt:  A0A3S4YK87 LinkDB All DBs Position 1:complement(400576..400797) Genome browser AA seq 73 aa AA seqDB search MAKGKVTFDQDYCKGCSLCVSVCPKDVLALKTDELNPKGYRPAYAKNPEDCIACQSCAII CPDSVISVYRIEE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggaaaagtcactttcgatcaagattactgcaaaggctgcagtctttgcgta tcggtctgcccgaaagatgttttggctctcaaaaccgatgaattgaacccgaagggctac agacccgcctatgcgaaaaatccggaagattgtatcgcatgccaaagctgtgcgatcatc tgccctgactctgtaatcagcgtctaccgcatagaagagtga

DBGET integrated database retrieval system