Pseudomonas inefficax: RIN61_01515 Help Entry RIN61_01515       CDS       T09811                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pix  Pseudomonas inefficax Pathway pix00261   Monobactam biosynthesis pix01100   Metabolic pathways pix01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pix00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RIN61_01515  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pix01008]     RIN61_01515 Polyketide biosynthesis proteins [BR:pix01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RIN61_01515 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WNN40014 LinkDB All DBs Position complement(332816..333037) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagtttcaggtagtggtcaaccacgaagag caatactcgatctggcccgattacaaagccatccccaacggctggcgtgccgtaggcaag agcggcctgaagaaggactgcctggcctacatcgatgaggtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagccgccgcccagtga

DBGET integrated database retrieval system