Parabacteroides johnsonii: LK449_04340 Help Entry LK449_04340       CDS       T07907                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pjo  Parabacteroides johnsonii Pathway pjo00020   Citrate cycle (TCA cycle) pjo01100   Metabolic pathways pjo01110   Biosynthesis of secondary metabolites pjo01120   Microbial metabolism in diverse environments pjo01200   Carbon metabolism pjo01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pjo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LK449_04340 Enzymes [BR:pjo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LK449_04340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_6 Fer4_9 Fer4_4 Fer4_17 Fer4_16 Fer4_15 Fer4_22 Fer4_8 Fer4_13 Fer4_3 Fer4_18 Chordopox_G2 Motif Other DBs NCBI-ProteinID:  UEA91443 LinkDB All DBs Position complement(1006465..1006698) Genome browser AA seq 77 aa AA seqDB search MAKIKGAVVVNTERCKGCNLCVVACPSDVLELHPREVNNKGYHYVYMKNPDDCIGCASCG LVCPDGCLTIYKKRIDN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcgaagataaaaggagctgttgttgtaaacacagagcgatgcaagggatgtaacctt tgcgtagtagcctgcccgtcggatgtactcgaattgcacccgcgtgaagtaaacaacaag ggataccattatgtgtacatgaaaaaccccgatgattgtatcggctgtgcaagttgcggg ttagtttgtccggacggttgtttaaccatctacaagaagagaattgacaattaa

DBGET integrated database retrieval system