Pseudomonas juntendi: L1P09_14800 Help Entry L1P09_14800       CDS       T08267                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pju  Pseudomonas juntendi Pathway pju00261   Monobactam biosynthesis pju01100   Metabolic pathways pju01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pju00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     L1P09_14800  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pju01008]     L1P09_14800 Polyketide biosynthesis proteins [BR:pju01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     L1P09_14800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UJM10616 LinkDB All DBs Position complement(3187901..3188122) Genome browser AA seq 73 aa AA seqDB search MTSVFDREDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKECLAYIDEVWTDMRP LSLRQKMAEAAPQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttctgtattcgaccgcgaagatatccagttccaagtagtggtcaaccatgaagag caatactcgatctggcccgactacaaagccatccccaacggctggcgtgcagtgggcaaa agcggcctgaaaaaggaatgcctggcgtatatcgacgaggtgtggaccgacatgcgcccc ctcagcctgcgccagaaaatggccgaagccgccccccagtga

DBGET integrated database retrieval system