Pseudomonas kermanshahensis: PZ739_17410 Help Entry PZ739_17410       CDS       T08964                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pkm  Pseudomonas kermanshahensis Pathway pkm00261   Monobactam biosynthesis pkm01100   Metabolic pathways pkm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pkm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PZ739_17410  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pkm01008]     PZ739_17410 Polyketide biosynthesis proteins [BR:pkm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PZ739_17410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WEL53613 LinkDB All DBs Position complement(3915446..3915667) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgtattcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag cagtactcgatctggcccgactacaaggcaatccccaatggctggcgagcagtaggcaag agcggcctgaagaaagactgcctggcctacatcgacgaggtctggaccgacatgcgcccg ctgagcctgcgccagaagatggccgaagccgcagcgcagtga

DBGET integrated database retrieval system