Plantactinospora sp. BC1: C6361_01920 Help Entry C6361_01920       CDS       T05377                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plab  Plantactinospora sp. BC1 Pathway plab00261   Monobactam biosynthesis plab01100   Metabolic pathways plab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C6361_01920  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plab01008]     C6361_01920 Polyketide biosynthesis proteins [BR:plab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C6361_01920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVT28460 LinkDB All DBs Position complement(503830..504024) Genome browser AA seq 64 aa AA seqDB search MTNPFEDPDRSYLVLRNPEDQHSLWPADIDVPAGWSVVHGPDGRANCLGYVETHWTDLRP ASSR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccgttcgaggaccccgaccgttcctacctggtcctccgcaatcccgaggac cagcacagcctctggccggccgacatcgacgtgccggcgggctggtccgtcgtgcacgga ccggacggcagggcgaactgtctcggctacgtcgagacgcactggaccgacctacggccg gcgagcagccggtag

DBGET integrated database retrieval system