Plantactinospora sp. BC1: C6361_05045 Help Entry C6361_05045       CDS       T05377                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plab  Plantactinospora sp. BC1 Pathway plab00261   Monobactam biosynthesis plab01100   Metabolic pathways plab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C6361_05045  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plab01008]     C6361_05045 Polyketide biosynthesis proteins [BR:plab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C6361_05045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVT28963 LinkDB All DBs Position complement(1214161..1214403) Genome browser AA seq 80 aa AA seqDB search MTTNPFEDPDGQYLVLVNDEGQHSLWPSFVDVPAGWTVVFGADGPQSRDACLAYVEENWT DLRPRSLRERMAAATAEPGS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaatccgttcgaggacccggacgggcagtacctcgtgctcgtcaacgacgag gggcagcactcgctctggccgtccttcgtggacgtaccggccggctggacggtggtgttc ggcgcggacggcccgcagtcccgggacgcctgcctggcgtacgtggaggagaactggacg gatctgcgtccccgcagcctgcgggagcggatggccgctgccacggccgagccgggtagc tga

DBGET integrated database retrieval system