Plantactinospora sp. BC1: C6361_24005 Help Entry C6361_24005       CDS       T05377                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plab  Plantactinospora sp. BC1 Pathway plab00261   Monobactam biosynthesis plab01100   Metabolic pathways plab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C6361_24005  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plab01008]     C6361_24005 Polyketide biosynthesis proteins [BR:plab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C6361_24005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVT32030 LinkDB All DBs Position 5495163..5495387 Genome browser AA seq 74 aa AA seqDB search MSEVESPRQRGYEVVRNHEGQYSIFPQGRPVPPGWELVGRAGSEEECLGYIEEVWTDMTP RSVRRRLDEASRGR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcgaggtcgagtcgccgcgacagcgcggctacgaggtggtccgcaaccacgagggc cagtactcgatctttccgcagggtcggccggtgccgcccggctgggaactggtcggccgc gccggctccgaggaggagtgcctcggctacatcgaagaggtgtggacggacatgaccccg cgctcggtacggcgccgcctcgacgaggcgtcccggggccggtag

DBGET integrated database retrieval system