Plantactinospora sp. BB1: C6W10_00790 Help Entry C6W10_00790       CDS       T05391                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plat  Plantactinospora sp. BB1 Pathway plat00261   Monobactam biosynthesis plat01100   Metabolic pathways plat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plat00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C6W10_00790  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plat01008]     C6W10_00790 Polyketide biosynthesis proteins [BR:plat01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C6W10_00790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVT35242 UniProt:  A0A2R4FCJ9 LinkDB All DBs Position 178348..178563 Genome browser AA seq 71 aa AA seqDB search MAFDDDQDDRRYTVVVNDEEQYSIWLADREIPAGWREVGRTGSKSECLEHISEVWTDMRP LSLRRSMEATA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggccttcgacgacgatcaggacgaccggcggtacacggtcgtggtgaatgacgaggag cagtactccatctggctggccgaccgggagatcccggccgggtggcgggaggtgggccgc acgggcagcaagtccgagtgcctggagcacatcagcgaggtgtggaccgacatgcgcccg ctgagcctgcgccggtcgatggaggcgacggcctga

DBGET integrated database retrieval system