Plantactinospora sp. BB1: C6W10_05925 Help Entry C6W10_05925       CDS       T05391                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plat  Plantactinospora sp. BB1 Pathway plat00261   Monobactam biosynthesis plat01100   Metabolic pathways plat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plat00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C6W10_05925  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plat01008]     C6W10_05925 Polyketide biosynthesis proteins [BR:plat01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C6W10_05925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Phage_H_T_join Motif Other DBs NCBI-ProteinID:  AVT36079 UniProt:  A0A2R4FF05 LinkDB All DBs Position complement(1409374..1409589) Genome browser AA seq 71 aa AA seqDB search MADEQTDDRVYRVVRNDEEQYSIWPADRDLPAGWHAEGTEGPRADCLARIGEVWTDMRPL SLRQRMAAAQS NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggctgacgagcagaccgacgaccgggtgtaccgggtggtccgcaacgacgaggagcag tactccatctggcccgccgaccgggatctgccggcgggctggcacgccgagggcaccgag ggcccgcgtgccgactgcctcgcccggatcggcgaggtctggaccgacatgcgcccgctg agcctgcgccagcggatggcggcagcgcagagctga

DBGET integrated database retrieval system