Plantactinospora sp. BB1: C6W10_19750 Help Entry C6W10_19750       CDS       T05391                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plat  Plantactinospora sp. BB1 Pathway plat00261   Monobactam biosynthesis plat01100   Metabolic pathways plat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plat00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C6W10_19750  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plat01008]     C6W10_19750 Polyketide biosynthesis proteins [BR:plat01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C6W10_19750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVT38302 UniProt:  A0A2R4FLD0 LinkDB All DBs Position 4499119..4499313 Genome browser AA seq 64 aa AA seqDB search MTNPFEDPDRSYLVLRNPEDQHSLWPADIDVPAGWSVVHGPDGRANCLGYVETHWTDLRP ASSR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccgttcgaggaccccgaccgttcctacctggtcctgcgcaatcccgaggac cagcacagcctctggccggccgacatcgacgtgccggcgggctggtccgtcgtgcacgga ccggacggcagggcgaactgtctcggctatgtcgagacgcactggaccgacctacggccg gcgagcagccggtag

DBGET integrated database retrieval system