Paucimonas lemoignei: NCTC10937_03969 Help Entry NCTC10937_03969   CDS       T05492                                  Symbol mbtH Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism plg  Paucimonas lemoignei Pathway plg00261   Monobactam biosynthesis plg01100   Metabolic pathways plg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NCTC10937_03969 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plg01008]     NCTC10937_03969 (mbtH) Polyketide biosynthesis proteins [BR:plg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NCTC10937_03969 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  SQF99803 LinkDB All DBs Position 1:complement(4428649..4428867) Genome browser AA seq 72 aa AA seqDB search MVFDREDLTFQVVCNHEEQYSIWPDYKAIPTGWRAVGMKGLKKECLEYIEQHWTDMRPLS LRQKMDQDKVVA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggtatttgaccgcgaagacctcacgtttcaggtggtgtgcaaccacgaagagcaatat tccatctggcctgattacaaagcgatccccacgggctggcgtgcggtgggcatgaagggg ttgaagaaggaatgcctggaatacatcgagcagcactggactgacatgcgtccgctgagc ctgcgacagaagatggatcaggacaaagtggtggcctga

DBGET integrated database retrieval system