Pseudomonas lijiangensis: KQP88_14910 Help Entry KQP88_14910       CDS       T08713                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plij  Pseudomonas lijiangensis Pathway plij00261   Monobactam biosynthesis plij01100   Metabolic pathways plij01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plij00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KQP88_14910  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plij01008]     KQP88_14910 Polyketide biosynthesis proteins [BR:plij01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KQP88_14910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QWU81354 LinkDB All DBs Position complement(3637618..3637845) Genome browser AA seq 75 aa AA seqDB search MTSVFDRDDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMEAQAVTTH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagttttcgaccgcgacgacatcgtctttcaggttgtggtcaaccacgaagag caatattccatctggcctgactacaaggcgatccccaacggctggcgcaccgtgggcaag agcggcttcaagaaggaatgcctggcctatatcgaagaagtgtggactgacatgcgtcca ttgagcctgcgccagaagatggaagcacaggctgttactacacactga

DBGET integrated database retrieval system