Plantactinospora sp. KBS50: CIK06_11200 Help Entry CIK06_11200       CDS       T05048                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism plk  Plantactinospora sp. KBS50 Pathway plk00261   Monobactam biosynthesis plk01100   Metabolic pathways plk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CIK06_11200  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plk01008]     CIK06_11200 Polyketide biosynthesis proteins [BR:plk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CIK06_11200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASW54626 UniProt:  A0A248YLP4 LinkDB All DBs Position 2522102..2522320 Genome browser AA seq 72 aa AA seqDB search MIVIDQFDDPTATFRVVLDTDGRPSVRSDHLPLPPGWTALHRPDDFQGCSDYLTRYLARR PVADERPEGGHR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgatcgtcatcgaccagttcgacgacccgaccgccaccttccgggtggtgctggacacc gacggccggccgtcggtgcgctcggaccacctgcccctgccgcccggctggaccgccctg caccggccggacgacttccagggctgttccgactacctgacccggtacctggcccgccgt ccggtcgcggacgagcggcccgagggaggccatcgatga

DBGET integrated database retrieval system