Plantactinospora sp. KBS50: CIK06_18395 Help Entry CIK06_18395       CDS       T05048                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism plk  Plantactinospora sp. KBS50 Pathway plk00261   Monobactam biosynthesis plk01100   Metabolic pathways plk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CIK06_18395  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plk01008]     CIK06_18395 Polyketide biosynthesis proteins [BR:plk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CIK06_18395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASW55731 UniProt:  A0A248YQ44 LinkDB All DBs Position 4279545..4279739 Genome browser AA seq 64 aa AA seqDB search MDRTYLVVVNDEEQYSIWDADRDLPAGWRGEGFRGPEADCLAHIEQIWTDMRPLSLRRAM ASGA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggaccgcacctacctcgtggtcgtcaacgacgaggagcagtactcgatctgggacgcc gaccgcgacctgccggccgggtggcgcggcgagggcttccgcggccccgaggccgactgc ctggcccacatcgaacagatctggaccgacatgcgtccgctcagcctgcgccgcgccatg gcgtcgggcgcctga

DBGET integrated database retrieval system