Plantactinospora sp. KBS50: CIK06_23525 Help Entry CIK06_23525       CDS       T05048                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plk  Plantactinospora sp. KBS50 Pathway plk00261   Monobactam biosynthesis plk01100   Metabolic pathways plk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CIK06_23525  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plk01008]     CIK06_23525 Polyketide biosynthesis proteins [BR:plk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CIK06_23525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASW56492 UniProt:  A0A248YSF4 LinkDB All DBs Position complement(5457322..5457543) Genome browser AA seq 73 aa AA seqDB search MTNPFEDPDGEYLVLVNEENQHSLWPSFAAVPAGWTVARAAGTHQECLDFVEQSWTDMRP RSLAESMQSPEPR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccgttcgaggacccggacggcgagtacctggtgttggtgaacgaggagaac cagcactccctgtggccgtcattcgcggcggtgcctgcgggctggacggtggccagggcg gccggaacccaccaggagtgtctggacttcgtcgagcagtcctggaccgacatgcggccc cggagcctggccgagtccatgcagagcccggaaccacggtga

DBGET integrated database retrieval system