Planococcus sp. PAMC 21323: Plano_3085 Help Entry Plano_3085        CDS       T03510                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pln  Planococcus sp. PAMC 21323 Pathway pln00790   Folate biosynthesis pln01100   Metabolic pathways pln01240   Biosynthesis of cofactors Module pln_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pln00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Plano_3085 Enzymes [BR:pln01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Plano_3085  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Plano_3085  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Plano_3085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AIY07050 UniProt:  A0A0B4RGM4 LinkDB All DBs Position 3188720..3189085 Genome browser AA seq 121 aa AA seqDB search MDFIHVNDMEFYGYHGVFPEETKLGQRFRMTVSLAVDLQQAGETDALEHTVHYGEVYEAC RSIVEGAPKKLVEAVAESVANRILAEFPLVKGIRVQLIKPDPPIPGHYKSVAIDLTRGKF V NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggattttattcacgtaaacgatatggagttttatggatatcacggtgtattccctgaa gaaacaaaattaggtcaacgattccgcatgacggtttcattggcagtggaccttcagcaa gctggagagacggacgctttagaacatacagtgcattacggagaagtctatgaagcttgc cgttcaatcgtcgaaggagcaccgaagaaattagtggaagctgtagcggaaagtgtagcc aaccgaattctagctgaatttcctttagtaaagggcattcgcgtgcagctaatcaaaccg gatccaccaattcctggtcactacaaatctgtagcaattgacttaacgcgaggaaagttc gtatga

DBGET integrated database retrieval system