Pseudomonas lundensis: AA042_01475 Help Entry AA042_01475       CDS       T05473                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plq  Pseudomonas lundensis Pathway plq00261   Monobactam biosynthesis plq01100   Metabolic pathways plq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AA042_01475  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plq01008]     AA042_01475 Polyketide biosynthesis proteins [BR:plq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AA042_01475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AOZ11467 LinkDB All DBs Position complement(324589..324810) Genome browser AA seq 73 aa AA seqDB search MSSVFDRDDILFQVVVNHEDQYSIWPDYKAIPNGWRAVGKSGLKPECLAYIEEVWTDMRP LSLRQKMDAVATH NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagttcagtatttgaccgcgacgatattctttttcaggtggtggtgaaccacgaagac cagtactcgatctggcctgattacaaagccattccgaacggctggcgtgcggtgggcaag agcggcttgaagcccgaatgcctggcctacatcgaggaggtgtggacggacatgcgcccg ctgagcctgcgccaaaagatggatgccgtggcaacgcactga

DBGET integrated database retrieval system