Photorhabdus luminescens: CE143_06075 Help Entry CE143_06075       CDS       T08000                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plui  Photorhabdus luminescens Pathway plui00261   Monobactam biosynthesis plui01100   Metabolic pathways plui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plui00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CE143_06075  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plui01008]     CE143_06075 Polyketide biosynthesis proteins [BR:plui01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CE143_06075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UJD74590 LinkDB All DBs Position 1414462..1414641 Genome browser AA seq 59 aa AA seqDB search MNYRVVCNKEDKHSIWPEGRTLPVGWQNVGFSGSEQECLDWIATYWRDPKLKVSGETLE NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgaattacagggtggtatgtaacaaagaggataagcactccatttggccagaaggtcgg acattaccggtagggtggcaaaatgtgggtttttcgggatcagaacaagaatgcctggat tggatagctacatattggcgtgatcccaaattgaaagtttccggagagacgttggaatga

DBGET integrated database retrieval system