Paenibacillus larvae: ERIC2_c15770 Help Entry ERIC2_c15770      CDS       T02963                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism plv  Paenibacillus larvae Pathway plv00261   Monobactam biosynthesis plv01100   Metabolic pathways plv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ERIC2_c15770  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plv01008]     ERIC2_c15770 Polyketide biosynthesis proteins [BR:plv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ERIC2_c15770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHD05401 UniProt:  V9W317 LinkDB All DBs Position 1520943..1521143 Genome browser AA seq 66 aa AA seqDB search MMNPFENADSTYKVLMNGEGQYSLWPAFIEVPAGWSIVHEQDSRQACLDYIELHWNNMEP NQLITK NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgatgaatccttttgagaacgcagacagcacatataaggtgttaatgaatggggaaggc cagtattctctctggcccgcttttatagaagtaccggccggatggagtatagtccatgaa caagatagtcgtcaggcctgcctggattatattgaattgcattggaataatatggagcca aatcagcttataacgaagtag

DBGET integrated database retrieval system