Paenibacillus lautus: D5F53_07340 Help Entry D5F53_07340       CDS       T05701                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism plw  Paenibacillus lautus Pathway plw00261   Monobactam biosynthesis plw01100   Metabolic pathways plw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D5F53_07340  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:plw01008]     D5F53_07340 Polyketide biosynthesis proteins [BR:plw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D5F53_07340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYB43112 UniProt:  A0A385TKF2 LinkDB All DBs Position 1563427..1563654 Genome browser AA seq 75 aa AA seqDB search MTNPFEQADGKFLVLMNHEGQYSLWPAFAAIPAGWNQVLGLSTREECVAYINENWVDLRP RSLYADAGAMPEPGS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccttttgagcaagccgacggcaagtttctagtactgatgaaccatgagggc caatattcgctctggccggcattcgcggctattccggccggctggaatcaggttctggga cttagcacgcgtgaggaatgcgtcgcctatatcaacgagaactgggtcgatttacggccg cggagcttgtatgccgatgcgggggcaatgccggaacctggatcatga

DBGET integrated database retrieval system