Prauserella marina: BAY61_01790 Help Entry BAY61_01790       CDS       T04988                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism pmad  Prauserella marina Pathway pmad00261   Monobactam biosynthesis pmad01100   Metabolic pathways pmad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmad00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BAY61_01790  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pmad01008]     BAY61_01790 Polyketide biosynthesis proteins [BR:pmad01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BAY61_01790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASR33934 UniProt:  A0A222VJ88 LinkDB All DBs Position 436762..436956 Genome browser AA seq 64 aa AA seqDB search MTNPFDDNDGRFYVLVNDEEQHSLWPTFAAVPDGWRIVFGEESREACLAYVEENWTDLRP ASIR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgacgaacccgttcgatgacaacgatggccggttttatgtgctcgtgaacgacgaggag cagcattcgctgtggccgacgttcgcggcggtgccggatggctggcgaatcgtgttcggt gaggaaagcagggaagcctgcctcgcctatgtggaggagaactggacggatctgaggccg gccagcatccgctga

DBGET integrated database retrieval system