Pseudomonas mandelii: OU5_1480 Help Entry OU5_1480          CDS       T03626                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism pman  Pseudomonas mandelii Pathway pman00261   Monobactam biosynthesis pman01100   Metabolic pathways pman01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pman00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OU5_1480  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pman01008]     OU5_1480 Polyketide biosynthesis proteins [BR:pman01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OU5_1480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHZ68559 UniProt:  A0A024E6J8 LinkDB All DBs Position complement(1677865..1678092) Genome browser AA seq 75 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPAGWRTVGKSGLKKECLAYIEETWTDMRP LSLRQKMDEQAAVAN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag caatactcgatctggcccgactacaaagcggtgcctgccggctggcgcaccgtgggcaag agcggcctgaaaaaggaatgcctggcctatatcgaagaaacctggaccgacatgcgcccg ttgagcttgcgtcagaagatggacgagcaggcggcagtggctaactaa

DBGET integrated database retrieval system