Poecilia mexicana (shortfin molly): 106932747 Help Entry 106932747         CDS       T08022                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei00860   Porphyrin metabolism pmei04216   Ferroptosis pmei04217   Necroptosis Brite KEGG Orthology (KO) [BR:pmei00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     106932747  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     106932747    04217 Necroptosis     106932747  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmei04147]     106932747 Enzymes [BR:pmei01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      106932747 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    106932747   Exosomal proteins of bladder cancer cells    106932747 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  106932747 NCBI-ProteinID:  XP_014867094 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MESQVRQNYHRDCEAAINRMVNMEMYASYTYTSMVRRNHTAETILFQLCDFLESHYLNEQ VESIKKLGDYITNLTRMDAHNNKMAEYLFDKHTLGGKS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggaatcccaggtgcgtcagaactaccaccgcgactgcgaggccgccattaacaggatg gtcaacatggagatgtatgcctcctacacctacacctctatggtaagaagaaatcacaca gctgaaacaattctgtttcagctgtgtgatttcctggagtcccactacctgaacgagcag gtggagtccatcaagaagctcggtgactacatcaccaacctgacccgcatggatgcccac aacaacaagatggcggagtacctgtttgacaagcacaccctgggaggcaaaagctaa

DBGET integrated database retrieval system