Parabacteroides merdae: INE87_00122 Help Entry INE87_00122       CDS       T07751                                  Name (GenBank) 4Fe-4S binding domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pmer  Parabacteroides merdae Pathway pmer00020   Citrate cycle (TCA cycle) pmer01100   Metabolic pathways pmer01110   Biosynthesis of secondary metabolites pmer01120   Microbial metabolism in diverse environments pmer01200   Carbon metabolism pmer01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pmer00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     INE87_00122 Enzymes [BR:pmer01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      INE87_00122 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_6 Fer4_9 Fer4_4 Fer4_17 Fer4_16 Fer4_15 Fer4_22 Fer4_8 Fer4_13 Fer4_3 Fer4_18 Chordopox_G2 Motif Other DBs NCBI-ProteinID:  QUT47705 LinkDB All DBs Position complement(129038..129271) Genome browser AA seq 77 aa AA seqDB search MAKIKGAVVVNTERCKGCNLCVVACPSDVLELHPREVNNKGYHYVYMKNPDDCIGCASCG LVCPDGCLTIYKKRIDN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcgaagataaaaggagctgttgttgtaaacacagagcgatgcaaaggatgtaacctc tgcgtagtagcctgcccgtcggatgttctcgaattgcacccgcgtgaagtaaacaacaag ggataccattatgtgtacatgaaaaaccccgatgactgcatcggttgtgcaagctgcggg ttggtttgtccggacggttgtttgaccatctacaagaagagaattgacaattga

DBGET integrated database retrieval system