Pseudomonas mosselii: CLJ08_23705 Help Entry CLJ08_23705       CDS       T07806                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pmol  Pseudomonas mosselii Pathway pmol00261   Monobactam biosynthesis pmol01100   Metabolic pathways pmol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmol00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CLJ08_23705  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pmol01008]     CLJ08_23705 Polyketide biosynthesis proteins [BR:pmol01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CLJ08_23705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATB67462 LinkDB All DBs Position 5139102..5139323 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag cagtattccatctggcccgactacaaggcgatccccaacggctggcgcgcggtgggcaag agcggcctgaagaaggactgcctggcctacatcgatgaggtctggaccgacatgcgccca ctgagcctgcgccagaagatggccgaagccgcggcgcagtaa

DBGET integrated database retrieval system