Pseudomonas multiresinivorans: G4G71_13995 Help Entry G4G71_13995       CDS       T07281                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pmui  Pseudomonas multiresinivorans Pathway pmui00261   Monobactam biosynthesis pmui01100   Metabolic pathways pmui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmui00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     G4G71_13995  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pmui01008]     G4G71_13995 Polyketide biosynthesis proteins [BR:pmui01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     G4G71_13995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QJP08938 UniProt:  A0A7Z3BL96 LinkDB All DBs Position 3070498..3070716 Genome browser AA seq 72 aa AA seqDB search MAFDREDAVYKVLVNGEEQYSLWPDYKEVPAGWREAGKRGSKADCLAYVEANWTDMRPLS LRQKMDAQAAGH NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggctttcgatcgcgaagacgcggtttacaaggtgctggtcaatggcgaagagcagtac tcgctgtggccggactacaaggaagtcccggccggctggcgcgaagccggcaagcggggg agcaaggccgattgcctggcctacgtcgaagcgaactggaccgacatgcgccccttgagc ctgcgacagaagatggacgcccaggctgcggggcactga

DBGET integrated database retrieval system