Pedobacter mucosus: LOK61_05850 Help Entry LOK61_05850       CDS       T08291                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pmuo  Pedobacter mucosus Pathway pmuo00790   Folate biosynthesis pmuo01100   Metabolic pathways pmuo01240   Biosynthesis of cofactors Module pmuo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pmuo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LOK61_05850 (folB) Enzymes [BR:pmuo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      LOK61_05850 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      LOK61_05850 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      LOK61_05850 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Cytokin_check_N Motif Other DBs NCBI-ProteinID:  UKT65302 LinkDB All DBs Position 1408428..1408793 Genome browser AA seq 121 aa AA seqDB search MSQFKQTVALRDVKCFALHGYYPEEQLIGNHFIVDLDTEFTPISFEDDLAQTVNYEDLNA IIIEEMKNTQKLLETVLKNIISKVIKLYPFVDQINVSVQKLNPPMPGQVGFSFVKLSYTS A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgagccaatttaaacaaaccgttgctttaagagatgttaaatgctttgcattgcatggt tattatccagaagaacaacttattggaaatcattttattgttgatttggataccgaattt acacccattagcttcgaggatgatttggctcaaaccgtaaattatgaagatttgaatgct attatcatagaagaaatgaaaaacactcaaaagctgctagaaacagtattgaaaaatata atatcgaaagtaattaagctttatccatttgtcgatcaaattaacgtgagtgtgcagaaa ttaaatccaccaatgcccggccaagttggtttttcatttgttaaattatcttatacatca gcctaa

DBGET integrated database retrieval system