Pseudomonas muyukensis: KSS95_17490 Help Entry KSS95_17490       CDS       T07704                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pmuy  Pseudomonas muyukensis Pathway pmuy00261   Monobactam biosynthesis pmuy01100   Metabolic pathways pmuy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmuy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KSS95_17490  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pmuy01008]     KSS95_17490 Polyketide biosynthesis proteins [BR:pmuy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KSS95_17490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXH33952 LinkDB All DBs Position complement(3983973..3984188) Genome browser AA seq 71 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQQMAAAQ NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgacatccagttccaggtagtggtcaaccatgaagag cagtattcgatctggccggactacaaggccattcccaacggctggcgcgcggtgggcaag agcggcctgaagaaggactgtctggcctacatcgacgaagtctggaccgacatgcgtccg ctgagtctgcgccagcagatggctgcggcgcagtaa

DBGET integrated database retrieval system